Publication | Open Access
The Isolation and Characterization of a Novel Corticostatin/Defensin-like Peptide from the Kidney
68
Citations
34
References
1996
Year
Renal InflammationEscherichia ColiPeptide ScienceNovel PeptideCellular PhysiologyMolecular PharmacologyIntercellular CommunicationCell SignalingCell PhysiologyMolecular PhysiologyBiochemistryNovel Corticostatin/defensin-like PeptideIon ChannelsMembrane BiologyRenal PathophysiologyNon-peptide LigandPharmacologySignal TransductionNatural SciencesPeptide LibraryPhysiologyCellular BiochemistryMedicineKidney ResearchNeuropeptides
We report the isolation and characterization of RK-1, a novel peptide found in the kidney. RK-1 is related to the corticostatin/defensins and has the sequence MPC-SCKKYCDPWEVIDGSCGLFNSKYCCREK but differs from the very cationic corticostatins/defensins in having only one arginine and a calculated charge at pH 7 of +1. Like some myeloid corticostatin/defensins RK-1 inhibits the growth of Escherichia coli. Since corticostatin/defensins effect ion flux in responsive epithelia we used volume changes in villus enterocytes as a model system to study the effects of RK-1 on ion channels in epithelial cells. At concentrations > or = 10(-9) M RK-1 decreased enterocyte volume in a dose-dependent manner through a pathway that requires extracellular calcium and is inhibited by niguldipine, a dihydropyridine-sensitive "L"-type Ca(2+)-channel blocker. In other assay systems for corticostatin-defensins, such as the inhibition of adrenocorticotropin-stimulated steroidogenesis, or cell lysis, RK-1 was inactive or only weakly active. These results demonstrate the existence of a novel system of biologically active peptides in the kidney represented by RK-1 which is antimicrobial and can activate epithelial ion channels in vitro.
| Year | Citations | |
|---|---|---|
Page 1
Page 1