Publication | Open Access
A potential wound‐healing‐promoting peptide from salamander skin
109
Citations
16
References
2014
Year
Wound healing in urodele amphibians is rapid, yet the skin‑wound healing mechanisms and effector molecules remain largely unknown, with no bioactive substance identified until the discovery of gene‑encoded tylotoin. The study aimed to identify and characterize tylotoin, a peptide from Tylototriton verrucosus skin, to elucidate the cellular and molecular mechanisms driving salamander skin wound healing. Tylotoin was isolated from salamander skin and evaluated in a murine full‑thickness dermal wound model, where its effects on keratinocyte, endothelial, and fibroblast motility and proliferation were assessed. In mice, tylotoin exhibited wound‑healing activity comparable to EGF (EC50 = 11.14 µg ml⁻¹), stimulating keratinocyte, endothelial, and fibro.
Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders.—Mu, L., Tang, J., Liu, H., Shen, C., Rong, M., Zhang, Z., Lai, R. A potential wound-healing-promoting peptide from salamander skin. FASEB J. 28, 3919-3929 (2014). www.fasebj.org
| Year | Citations | |
|---|---|---|
Page 1
Page 1